DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CTSF

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_003784.2 Gene:CTSF / 8722 HGNCID:2531 Length:484 Species:Homo sapiens


Alignment Length:338 Identity:129/338 - (38%)
Similarity:181/338 - (53%) Gaps:32/338 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLLALLAVAQAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKV 102
            ||...|.|..|..|.:        |.:.:.:.|:.:.|.|:||.:|..|..: |:..|....|..
Human   174 PLSQDLPVKMASIFKN--------FVITYNRTYESKEEARWRLSVFVNNMVR-AQKIQALDRGTA 229

  Fly   103 SFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVT 167
            .:  .|.|::||...|||.:.  .|..|.|:.....:..|.|..::      |...|||:|||||
Human   230 QY--GVTKFSDLTEEEFRTIY--LNTLLRKEPGNKMKQAKSVGDLA------PPEWDWRSKGAVT 284

  Fly   168 AVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKD 232
            .|||||.||||||||.||.:|||.|...|.|:|||||.|:||...  :..|.|||..||:..||:
Human   285 KVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKM--DKACMGGLPSNAYSAIKN 347

  Fly   233 NGGIDTEKSYPYEAIDDSCHFN--KGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHE 295
            .||::||..|.|:....||:|:  |..|...|.  .::.| :|:|:|..:|..||:||||:|.  
Human   348 LGGLETEDDYSYQGHMQSCNFSAEKAKVYINDS--VELSQ-NEQKLAAWLAKRGPISVAINAF-- 407

  Fly   296 SFQFYSEGVYN--EPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKEN 358
            ..|||..|:..  .|.|....:||.||:||:| :.|...:|.:||||||.||:||:..:.|. ..
Human   408 GMQFYRHGISRPLRPLCSPWLIDHAVLLVGYG-NRSDVPFWAIKNSWGTDWGEKGYYYLHRG-SG 470

  Fly   359 QCGIASASSYPLV 371
            .||:.:.:|..:|
Human   471 ACGVNTMASSAVV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 15/58 (26%)
Peptidase_C1 154..370 CDD:278538 99/219 (45%)
CTSFNP_003784.2 Inhibitor_I29 187..243 CDD:214853 16/66 (24%)
Peptidase_C1 271..482 CDD:278538 99/225 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.