DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL1 and AT1G06260

DIOPT Version :10

Sequence 1:NP_523735.2 Gene:CtsL1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_563764.1 Gene:AT1G06260 / 837137 AraportID:AT1G06260 Length:343 Species:Arabidopsis thaliana


Alignment Length:129 Identity:28/129 - (21%)
Similarity:56/129 - (43%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTLALLVLCIVTSPIESRYREKDAKKGKAQPILPQMIVPSPLMNLCSGDREMKLVCHCSPDDPHV 73
            |.|:.:.|.:|.:.....:.|.::.:.:...||......:|.:....|..::     |||....:
plant   165 LVLSQIGLDVVRTDRYLCFYESESNQARLWDILSIYTWLNPDIGYVQGMNDI-----CSPMIILL 224

  Fly    74 KAQKANCWIFSKDLPRKDANWLAFQTQSTLEQLKITVQ-KIGNLAYIPSDV---LHTLKYLKQL 133
            :.:....|.|.:.:.|...|   |:|.:|    .:.|| ::|.|:.:...|   ||  ::|:.|
plant   225 EDEADAFWCFERAMRRLREN---FRTTAT----SMGVQTQLGMLSQVIKTVDPRLH--QHLEDL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 14/59 (24%)
Peptidase_C1 154..370 CDD:425470
AT1G06260NP_563764.1 Inhibitor_I29 43..98 CDD:214853
Peptidase_C1 127..342 CDD:425470 28/129 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.