DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and AT4G16190

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_567489.1 Gene:AT4G16190 / 827311 AraportID:AT4G16190 Length:373 Species:Arabidopsis thaliana


Alignment Length:321 Identity:122/321 - (38%)
Similarity:173/321 - (53%) Gaps:40/321 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGF 126
            ||.::.|.|..:.|...|.::|..|..: |:.||......|.   .|.:::||...|||:     
plant    58 FKSKYEKTYATQVEHDHRFRVFKANLRR-ARRNQLLDPSAVH---GVTQFSDLTPKEFRR----- 113

  Fly   127 NYTLHKQLRAADESFKGVTFISPAHV----TLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGAL 187
                 |.|......|:..|....|.:    .||...|||.:||||.||:||.|||||:||:.|||
plant   114 -----KFLGLKRRGFRLPTDTQTAPILPTSDLPTEFDWREQGAVTPVKNQGMCGSCWSFSAIGAL 173

  Fly   188 EGQHFRKSGVLVSLSEQNLVDCSTKYG-------NNGCNGGLMDNAFRYIKDNGGIDTEKSYPYE 245
            ||.||..:..|||||||.||||..:..       ::||:||||:|||.|....||:..|:.|||.
plant   174 EGAHFLATKELVSLSEQQLVDCDHECDPAQANSCDSGCSGGLMNNAFEYALKAGGLMKEEDYPYT 238

  Fly   246 AID-DSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQ 309
            ..| .:|.|:|..:.|:...|: :...||.::|..:...||:::||:|..  .|.|..|| :.|.
plant   239 GRDHTACKFDKSKIVASVSNFS-VVSSDEDQIAANLVQHGPLAIAINAMW--MQTYIGGV-SCPY 299

  Fly   310 CDAQNLDHGVLVVGFGTDESG--------EDYWLVKNSWGTTWGDKGFIKMLRNKENQCGI 362
            ..:::.|||||:||||:  ||        :.||::|||||..||:.|:.|:.|...|.||:
plant   300 VCSKSQDHGVLLVGFGS--SGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGM 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 15/55 (27%)
Peptidase_C1 154..370 CDD:278538 99/225 (44%)
AT4G16190NP_567489.1 Inhibitor_I29 55..110 CDD:214853 15/55 (27%)
Peptidase_C1 140..365 CDD:278538 99/225 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.