DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and Ctsb

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_072119.2 Gene:Ctsb / 64529 RGDID:621509 Length:339 Species:Rattus norvegicus


Alignment Length:260 Identity:81/260 - (31%)
Similarity:107/260 - (41%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VTLPKSVD----WRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFR-----KSGVLVSLSEQNLV 207
            :.||:|.|    |.....:..::|||.|||||||   ||:|....|     ...|.|.:|.::|:
  Rat    78 INLPESFDAREQWSNCPTIAQIRDQGSCGSCWAF---GAVEAMSDRICIHTNGRVNVEVSAEDLL 139

  Fly   208 DCSTKYGNNGCNGGLMDNAFRYIKD----NGGI------------------------------DT 238
            .|......:|||||....|:.:...    :||:                              ||
  Rat   140 TCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDT 204

  Fly   239 EKSYPYEAIDDSCHFNKGTVGATDR--GFTDIPQGDEKK--MAEAVATVGPVSVAIDASHESFQF 299
            .|      .:..|.....|....|:  |:|.....|.:|  ||| :...|||..|... ...|..
  Rat   205 PK------CNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAE-IYKNGPVEGAFTV-FSDFLT 261

  Fly   300 YSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIAS 364
            |..|||.....|... .|.:.::|:|. |:|..||||.|||...|||.||.|:||. ||.|||.|
  Rat   262 YKSGVYKHEAGDVMG-GHAIRILGWGI-ENGVPYWLVANSWNVDWGDNGFFKILRG-ENHCGIES 323

  Fly   365  364
              Rat   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853
Peptidase_C1 154..370 CDD:278538 81/258 (31%)
CtsbNP_072119.2 Propeptide_C1 26..65 CDD:285358
Peptidase_C1A_CathepsinB 81..328 CDD:239111 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.