DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and Ctsz

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_071720.1 Gene:Ctsz / 64138 MGIID:1891190 Length:306 Species:Mus musculus


Alignment Length:232 Identity:84/232 - (36%)
Similarity:121/232 - (52%) Gaps:34/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FISPAHVTLPKSVDWRTKGAV---TAVKDQ---GHCGSCWAFSSTGALEGQ-HFRKSGVLVS--L 201
            ::|||  .|||:.|||....|   :..::|   .:||||||..||.|:..: :.::.|...|  |
Mouse    58 YLSPA--DLPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGAWPSILL 120

  Fly   202 SEQNLVDCSTKYGNNG-CNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSC-HFNK-GTVGA--- 260
            |.||::||    ||.| |.||.....:.|...: ||..|....|:|.|..| .||: ||...   
Mouse   121 SVQNVIDC----GNAGSCEGGNDLPVWEYAHKH-GIPDETCNNYQAKDQDCDKFNQCGTCTEFKE 180

  Fly   261 --TDRGFTDIPQGD-------EKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLD 316
              |.:.:|....||       ||.|||..|. ||:|..|.|: |....|:.|:|.|.| |...::
Mouse   181 CHTIQNYTLWRVGDYGSLSGREKMMAEIYAN-GPISCGIMAT-EMMSNYTGGIYAEHQ-DQAVIN 242

  Fly   317 HGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKML 353
            |.:.|.|:|....|.:||:|:||||..||:||:::::
Mouse   243 HIISVAGWGVSNDGIEYWIVRNSWGEPWGEKGWMRIV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853
Peptidase_C1 154..370 CDD:278538 81/224 (36%)
CtszNP_071720.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 81/224 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.