DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and ctsz

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001006043.1 Gene:ctsz / 450022 ZFINID:ZDB-GENE-041010-139 Length:301 Species:Danio rerio


Alignment Length:240 Identity:82/240 - (34%)
Similarity:122/240 - (50%) Gaps:33/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LPKSVDWRT-KGA--VTAVKDQ---GHCGSCWAFSSTGALEGQ-HFRKSGVLVS--LSEQNLVDC 209
            |||..|||. ||.  |:..::|   .:||||||..||.||..: :.::.....|  ||.||::||
Zfish    54 LPKEWDWRNIKGVNYVSTTRNQHIPQYCGSCWAHGSTSALADRINIKRKAAWPSAYLSVQNVIDC 118

  Fly   210 STKYGNNG-CNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCH-FNK----GTVGATD--RGFT 266
                |:.| |:||.....:.| ..|.||..|....|:|.|..|. ||:    .|.|..:  :.||
Zfish   119 ----GDAGSCSGGDHSGVWEY-AHNKGIPDETCNNYQAKDQDCKPFNQCGTCTTFGVCNIVKNFT 178

  Fly   267 DIPQGDE------KKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFG 325
            ....||.      .||...:.:.||:|..|.|: :....|:.|:|:| ......::|.|.|.|:|
Zfish   179 LWKVGDYGSASGLDKMKAEIYSGGPISCGIMAT-DKLDAYTGGLYSE-YVQEPYINHIVSVAGWG 241

  Fly   326 TDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPL 370
            .||:|.::|:|:||||..||:||:::::.:....   .|.|.|.|
Zfish   242 VDENGVEFWVVRNSWGEPWGEKGWLRIVTSAYKG---GSGSQYNL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853
Peptidase_C1 154..370 CDD:278538 81/238 (34%)
ctszNP_001006043.1 Peptidase_C1A_CathepsinX 54..295 CDD:239149 82/240 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.