DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and Y71H2AM.25

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001040887.1 Gene:Y71H2AM.25 / 4363054 WormBaseID:WBGene00044760 Length:299 Species:Caenorhabditis elegans


Alignment Length:223 Identity:75/223 - (33%)
Similarity:117/223 - (52%) Gaps:14/223 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFR-KSGVLVSLSEQNLVDCSTKYGNN 216
            |..:.:|||.||.|..|||||.|.:..||:.:.::|..:.: .:|.|:|.|||.|:||. .:|..
 Worm    81 TTEEFLDWRDKGIVGPVKDQGKCNASHAFAISSSIESMYAKATNGSLLSFSEQQLIDCD-DHGFK 144

  Fly   217 GCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDD-SCHFN--KGTVGATDRGFTDIPQGDEKKMAE 278
            ||......||..|...: ||:||..|||...:: .|.|:  |..:...|..|.   ..:|.:..|
 Worm   145 GCEEQPAINAVSYFIFH-GIETEADYPYAGKENGKCTFDSTKSKIQLKDAEFV---VSNETQGKE 205

  Fly   279 AVATVGPVSVAIDASHESFQFYSEGVYNE--PQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWG 341
            .|...||....:.|. .|...|..|:||.  .:|.:.:....:::||:|. |..:.||:||.|:|
 Worm   206 LVTNYGPAFFTMRAP-PSLYDYKIGIYNPSIEECTSTHEIRSMVIVGYGI-EGVQKYWIVKGSFG 268

  Fly   342 TTWGDKGFIKMLRNKENQCGIASASSYP 369
            |:||::|::|:.|: .|.|.:|...:.|
 Worm   269 TSWGEQGYMKLARD-VNACAMADFITVP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853
Peptidase_C1 154..370 CDD:278538 74/222 (33%)
Y71H2AM.25NP_001040887.1 Peptidase_C1A 84..295 CDD:239068 73/218 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.