DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CG11459

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster


Alignment Length:349 Identity:135/349 - (38%)
Similarity:198/349 - (56%) Gaps:26/349 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TMRTAVLLPLLALLAVAQAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHN 94
            |.|..|:..|:.||.|  .:....|...||..:|.::.|.|::  .:::...::.:....:..||
  Fly     3 TPRLTVVHGLILLLLV--ELGLTAVSDTEWDQYKAKYNKQYRN--RDKYHRALYEQRVLAVESHN 63

  Fly    95 QRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNY------TLHKQLRAADESFKGVTFISPAHVT 153
            |.:.:|||:||:.:||::|.   :.|.|   |||      .|.....|..|:   |.:.....:|
  Fly    64 QLYLQGKVAFKMGLNKFSDT---DQRIL---FNYRSSIPAPLETSTNALTET---VNYKRYDQIT 119

  Fly   154 LPKSVDWRTKGAVTAVKDQG-HCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNG 217
              :.:|||..|.::.|.||| .|.||||||::|.||....:|.|.||.||.::|||| ..|.|||
  Fly   120 --EGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDC-VPYPNNG 181

  Fly   218 CNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVAT 282
            |:||.:..||.|.:|: ||.|::|||||.:...|.:.......|..|:..:...||:::||.|..
  Fly   182 CSGGWVSVAFNYTRDH-GIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYN 245

  Fly   283 VGPVSVAIDASHESFQFYSEGVYNEPQCDA--QNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWG 345
            :|||:|:||..||.|..||.||.:.|.|.:  |:|.|.||:|||||.....|||::|||:||.||
  Fly   246 IGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWG 310

  Fly   346 DKGFIKMLRNKENQCGIASASSYP 369
            :.|::|:.||..|.||:||...||
  Fly   311 ESGYLKLARNANNMCGVASLPQYP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 15/58 (26%)
Peptidase_C1 154..370 CDD:278538 101/219 (46%)
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 15/59 (25%)
Peptidase_C1A 120..334 CDD:239068 99/215 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452940
Domainoid 1 1.000 49 1.000 Domainoid score I11780
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.