DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CG12163

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster


Alignment Length:325 Identity:129/325 - (39%)
Similarity:186/325 - (57%) Gaps:27/325 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHH 117
            |.|...::.|::...:.|....|.:.||:||.:|...|.:.|   |....|.|..:.::||:...
  Fly   302 DKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN---ANEMGSAKYGITEFADMTSS 363

  Fly   118 EFRQLMNGFNYTLHKQLRAADE--SFKGVTFISPA-HVTLPKSVDWRTKGAVTAVKDQGHCGSCW 179
            |:::         ...|...||  :..|...:.|| |..|||..|||.|.|||.||:||.|||||
  Fly   364 EYKE---------RTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCW 419

  Fly   180 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY 244
            |||.||.:||.:..|:|.|...|||.|:||.|.  ::.|||||||||::.|||.||::.|..|||
  Fly   420 AFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYPY 482

  Fly   245 EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYN--E 307
            :|..:.||||:........||.|:|:|:|..|.|.:...||:|:.|:|:  :.|||..||.:  :
  Fly   483 KAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYRGGVSHPWK 545

  Fly   308 PQCDAQNLDHGVLVVGFGTDESGE-----DYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASS 367
            ..|..:||||||||||:|..:...     .||:||||||..||::|:.::.|. :|.||::..::
  Fly   546 ALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEMAT 609

  Fly   368  367
              Fly   610  609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 15/58 (26%)
Peptidase_C1 154..370 CDD:278538 104/221 (47%)
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 15/59 (25%)
Peptidase_C1A 395..611 CDD:239068 103/220 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D71650at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.