DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and ctss1

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_017207692.1 Gene:ctss1 / 393398 ZFINID:ZDB-GENE-040426-1583 Length:342 Species:Danio rerio


Alignment Length:347 Identity:142/347 - (40%)
Similarity:205/347 - (59%) Gaps:24/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITMRTAVLLPLLALLAVAQAVSFADV--VMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIA 91
            :.:|.|::|..::|:.       .::  :..:|.|:|.:|.|.|::..|||.|..::.:|...|.
Zfish    16 LVIRCALVLVCVSLVG-------CEIRRLTNQWTTWKSQHNKTYRNTREERLRRSVWKQNLQDIL 73

  Fly    92 KHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGV--TFISPAHVTL 154
            .||:..|.|..|:.|.:|:.:|:...|... |||.          .:|.|..|  ||..|:..||
Zfish    74 LHNEAAAVGLHSYTLGLNQLSDMTADEVND-MNGL----------LEEDFPDVNATFSPPSLQTL 127

  Fly   155 PKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCN 219
            |:.|:|...|.|:.|::||.||||||||:.|:||.|..|::..||.||.|||:|||...||.||.
Zfish   128 PQRVNWTEHGMVSPVQNQGPCGSCWAFSAVGSLEAQMKRRTAALVPLSAQNLLDCSVSLGNRGCK 192

  Fly   220 GGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVG 284
            ||.:..||.|:..|.|||:...||||..:..|.::.........||..:|:.:|..:..|||.:|
Zfish   193 GGFLSRAFLYVIQNRGIDSSTFYPYEHKEGVCRYSVSGRAGYCTGFRIVPRHNEAALQSAVANIG 257

  Fly   285 PVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGF 349
            ||||.|:|...||..|..|:||:|:|.:..::|.|||||:|: |:|:|||||||||||.||:.|:
Zfish   258 PVSVGINAKLLSFHRYRSGIYNDPKCSSALINHAVLVVGYGS-ENGQDYWLVKNSWGTAWGENGY 321

  Fly   350 IKMLRNKENQCGIASASSYPLV 371
            |:|.||| |.|||:|...||.:
Zfish   322 IRMARNK-NMCGISSFGIYPTI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 20/58 (34%)
Peptidase_C1 154..370 CDD:278538 106/215 (49%)
ctss1XP_017207692.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 1 1.000 - - FOG0000114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X64
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.