powered by:
Protein Alignment Cp1 and cer
DIOPT Version :9
Sequence 1: | NP_523735.2 |
Gene: | Cp1 / 36546 |
FlyBaseID: | FBgn0013770 |
Length: | 371 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 27/65 - (41%) |
Similarity: | 44/65 - (67%) |
Gaps: | 1/65 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 EEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQ 121
|||..:|.:..|||:.| |:..|.:|:.|:|.:|.:||::|.:|:|::|:.:|..|||...||.|
Fly 7 EEWVEYKSKFDKNYEAE-EDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
Fly 122 121
Fly 71 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
49 |
1.000 |
Domainoid score |
I11780 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.