DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL1 and cer

DIOPT Version :10

Sequence 1:NP_523735.2 Gene:CtsL1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster


Alignment Length:65 Identity:27/65 - (41%)
Similarity:44/65 - (67%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQ 121
            |||..:|.:..|||:.| |:..|.:|:.|:|.:|.:||::|.:|:|::|:.:|..|||...||.|
  Fly     7 EEWVEYKSKFDKNYEAE-EDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70

  Fly   122  121
              Fly    71  70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 22/58 (38%)
Peptidase_C1 154..370 CDD:425470
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 22/59 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.