DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CG6357

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster


Alignment Length:155 Identity:39/155 - (25%)
Similarity:60/155 - (38%) Gaps:48/155 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLM 123
            |..|.::.:.:|||:||...|..:|.:|...|.|||.:|..|.:|||..:|:::||...|::   
  Fly   252 WEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGNISFKKGINQWSDLTVEEWK--- 313

  Fly   124 NGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALE 188
                   :||..|.:..|      |....|...|.|.|         |...|.:.|         
  Fly   314 -------NKQRPAFNPEF------SKVEATTKISKDKR---------DDNTCQAAW--------- 347

  Fly   189 GQHFRKSGVLVSLSEQNLVDCSTKY 213
                          ::.|:|...||
  Fly   348 --------------KKFLIDFGAKY 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 22/58 (38%)
Peptidase_C1 154..370 CDD:278538 10/60 (17%)
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853 22/58 (38%)
Inhibitor_I29 347..406 CDD:214853 5/35 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.