DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and Ctsf

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001029282.1 Gene:Ctsf / 361704 RGDID:1308181 Length:462 Species:Rattus norvegicus


Alignment Length:344 Identity:122/344 - (35%)
Similarity:174/344 - (50%) Gaps:44/344 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLLALLAVAQAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKV 102
            ||....:|..|..|.|        |...:.:.|:...|.::||.:|..|..: |:..|....|..
  Rat   152 PLPQDFSVKMATLFKD--------FMTTYNRTYESREEAQWRLTVFARNMIR-AQKIQALDRGTA 207

  Fly   103 SFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSV--------D 159
            .:  .:.|::||...||..:.  .|..|.|:              |...::|.||:        |
  Rat   208 QY--GITKFSDLTEEEFHTIY--LNPLLQKE--------------SGGKMSLAKSINDLAPPEWD 254

  Fly   160 WRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMD 224
            ||.|||||.|||||.||||||||.||.:|||.|...|.|:|||||.|:||...  :..|.|||..
  Rat   255 WRKKGAVTEVKDQGMCGSCWAFSVTGNVEGQWFLNRGTLLSLSEQELLDCDKM--DKACMGGLPS 317

  Fly   225 NAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVA 289
            ||:..||:.||::||..|.|:....:|:|:............::.: ||.|:|..:|..||:|||
  Rat   318 NAYTAIKNLGGLETEDDYGYQGHVQACNFSTQMAKVYINDSVELSR-DENKIAAWLAQKGPISVA 381

  Fly   290 IDASHESFQFYSEGVYN--EPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKM 352
            |:|.  ..|||..|:.:  .|.|....:||.||:||:| :.|...||.:|||||..||::|:..:
  Rat   382 INAF--GMQFYRHGIAHPFRPLCSPWFIDHAVLLVGYG-NRSNIPYWAIKNSWGRDWGEEGYYYL 443

  Fly   353 LRNKENQCGIASASSYPLV 371
            .|. ...||:.:.:|..:|
  Rat   444 YRG-SGACGVNTMASSAVV 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 13/58 (22%)
Peptidase_C1 154..370 CDD:278538 96/225 (43%)
CtsfNP_001029282.1 Inhibitor_I29 165..221 CDD:214853 15/66 (23%)
Peptidase_C1 249..460 CDD:395062 93/217 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.