DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CtsB1

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:386 Identity:104/386 - (26%)
Similarity:153/386 - (39%) Gaps:111/386 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LLALLAVAQAVS-------------FADVVMEEWHTFKLEHRKNYQDETEERF--RLKIFNENKH 88
            ||.|:|.|.:|:             |.:||..:..|:.:  .:|:.....|..  ||...:.:.|
  Fly     3 LLLLVATAASVAALTSGEPSLLSDEFIEVVRSKAKTWTV--GRNFDASVTEGHIRRLMGVHPDAH 65

  Fly    89 KIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVT 153
            |.|..::|    :|...|.||                          :.||              
  Fly    66 KFALPDKR----EVLGDLYVN--------------------------SVDE-------------- 86

  Fly   154 LPKSVD----WRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVS--LSEQNLVDCSTK 212
            ||:..|    |.....:..::|||.|||||||.:..|:..:....||..|:  .|..:||.|...
  Fly    87 LPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHT 151

  Fly   213 YGNNGCNGGLMDNAFRYIKDNGGI------DTEKSYPYEAIDDSCHFNKGT------VGATDR-- 263
            .| .|||||....|:.|....|.:      ..:...|||......|.| ||      .|.|.:  
  Fly   152 CG-FGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVN-GTRPPCAHGGRTPKCS 214

  Fly   264 -----GFT-----DIPQGDE--------KKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQC 310
                 |:|     |...|.:        :::.|.:.|.|||..|... :|....|.:|||.... 
  Fly   215 HVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKDGVYQHEH- 277

  Fly   311 DAQNL-DHGVLVVGFGTDESGED---YWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASS 367
             .:.| .|.:.::|:|.  .||:   |||:.|||.|.|||.||.::||.::: |||.|:.|
  Fly   278 -GKELGGHAIRILGWGV--WGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH-CGIESSIS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 13/60 (22%)
Peptidase_C1 154..370 CDD:278538 80/256 (31%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/41 (20%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452944
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.