DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and si:dkey-239j18.2

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001274132.1 Gene:si:dkey-239j18.2 / 321853 ZFINID:ZDB-GENE-121214-52 Length:335 Species:Danio rerio


Alignment Length:340 Identity:171/340 - (50%)
Similarity:229/340 - (67%) Gaps:13/340 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LLPLLALLAVAQAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEG 100
            ||..|.:.||..|.|....:.:.|:::|.:|.|:|.::.|...|: |:.||..||.:||..::.|
Zfish     5 LLVTLYISAVFAAPSIDIQLDDHWNSWKSQHGKSYHEDVEVGRRM-IWEENLRKIEQHNFEYSLG 68

  Fly   101 KVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGA 165
            ..:||:.:|::.|:.:.||||.|||:.:.       .:.:.:|..|:.|.....|:.||||.:|.
Zfish    69 NHTFKMGMNQFGDMTNEEFRQAMNGYKHD-------PNRTSQGPLFMEPKFFAAPQQVDWRQRGY 126

  Fly   166 VTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYI 230
            ||.||||..|||||:||||||||||.|||:|.|:|:|||||||||..:||.||||||||.||:|:
Zfish   127 VTPVKDQKQCGSCWSFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPHGNQGCNGGLMDQAFQYV 191

  Fly   231 KDNGGIDTEKSYPYEAIDD-SCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASH 294
            |:|.|:|:|:||||.|.|| .|.::.....|...||.|||:|:|..:..|||.||||||||||||
Zfish   192 KENKGLDSEQSYPYLARDDLPCRYDPRFNVAKITGFVDIPKGNELALMNAVAAVGPVSVAIDASH 256

  Fly   295 ESFQFYSEGVYNEPQCDAQNLDHGVLVVGF---GTDESGEDYWLVKNSWGTTWGDKGFIKMLRNK 356
            :|.|||..|:|.|..|.:| |||.|||||:   |.|.:|..||:|||||...|||||:|.|.::|
Zfish   257 QSLQFYQSGIYYERACTSQ-LDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDK 320

  Fly   357 ENQCGIASASSYPLV 371
            .|.||||:.:||||:
Zfish   321 NNHCGIATMASYPLM 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 19/58 (33%)
Peptidase_C1 154..370 CDD:278538 133/219 (61%)
si:dkey-239j18.2NP_001274132.1 Inhibitor_I29 28..86 CDD:214853 19/58 (33%)
Peptidase_C1 115..334 CDD:278538 133/219 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 367 1.000 Inparanoid score I2109
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 1 1.000 - - FOG0000114
OrthoInspector 1 1.000 - - otm25207
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X64
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.