DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL1 and Tinag

DIOPT Version :10

Sequence 1:NP_523735.2 Gene:CtsL1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001005549.1 Gene:Tinag / 300846 RGDID:1359482 Length:475 Species:Rattus norvegicus


Alignment Length:225 Identity:64/225 - (28%)
Similarity:96/225 - (42%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DQGHCGSCWAFSSTG------ALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRY 229
            ||.:|.:.||||:..      |::.    |.....:||.|||:.|..| ..:|||.|.:|.|:.:
  Rat   235 DQKNCAASWAFSTASVAADRIAIQS----KGRYTANLSPQNLISCCAK-NRHGCNSGSIDRAWWF 294

  Fly   230 IKDNGGIDTEKSYP----YEAIDDSCHFNKGTVGATDRGFT-DIPQGDEKK-------------- 275
            ::.. |:.:...||    ....::||.....:.|...|..| ..|...||.              
  Rat   295 LRKR-GLVSHACYPLFKEQSTNNNSCAMASRSDGRGKRHATRPCPNSFEKSNRIYQCSPPYRISS 358

  Fly   276 -----MAEAVATVGPVSVAIDASHESFQFYSEGVY-------NEPQCDAQNLDHGVLVVGFGT-- 326
                 |.|.:.. |||. ||...||.|.:|..|:|       .||:...:...|.|.:.|:||  
  Rat   359 NETEIMREIIQN-GPVQ-AIMQVHEDFFYYKTGIYRHVVSTNEEPEKYRKLRTHAVKLTGWGTLR 421

  Fly   327 --DESGEDYWLVKNSWGTTWGDKGFIKMLR 354
              ....|.:|:..||||.:||:.|:.::||
  Rat   422 GAQGKKEKFWIAANSWGKSWGENGYFRILR 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL1NP_523735.2 Inhibitor_I29 59..118 CDD:214853
Peptidase_C1 154..370 CDD:425470 64/225 (28%)
TinagNP_001005549.1 Somatomedin_B 61..104 CDD:470596
Peptidase_C1A_CathepsinB 217..465 CDD:239111 64/225 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.