DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and Ctsc

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_058793.1 Gene:Ctsc / 25423 RGDID:2445 Length:462 Species:Rattus norvegicus


Alignment Length:383 Identity:101/383 - (26%)
Similarity:172/383 - (44%) Gaps:107/383 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AQAVSFA---------DVVMEEWHTFKLEHRKNYQDET----------EERFRLKIFNENKHKIA 91
            ::|:|:.         ||:...|..|..:...|:.::.          :|::..::::.|     
  Rat   112 SRAISYCHETMTGWVHDVLGRNWACFVGKKMANHSEKVYVNVAHLGGLQEKYSERLYSHN----- 171

  Fly    92 KHNQRFAEGKVSFKLAVN----KYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHV 152
             ||         |..|:|    .:....:.|:.:|      ::...:|.:..|.: :....||.:
  Rat   172 -HN---------FVKAINSVQKSWTATTYEEYEKL------SIRDLIRRSGHSGR-ILRPKPAPI 219

  Fly   153 T---------LPKSVDWR-TKGA--VTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVS----- 200
            |         ||:|.||| .:|.  |:.|::|..||||::|:|.|.||.    :..:|.:     
  Rat   220 TDEIQQQILSLPESWDWRNVRGINFVSPVRNQESCGSCYSFASLGMLEA----RIRILTNNSQTP 280

  Fly   201 -LSEQNLVDCSTKYGNNGCNGG---LMDNAFRYIKDNGGIDTEKSYPYEAIDDSC---------- 251
             ||.|.:|.|| .|. .||:||   |:  |.:|.:|.|.:: |..:||.|.|..|          
  Rat   281 ILSPQEVVSCS-PYA-QGCDGGFPYLI--AGKYAQDFGVVE-ENCFPYTATDAPCKPKENCLRYY 340

  Fly   252 ----HFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVY-----NE 307
                ::..|..|..          :|..|...:...||::||.:. |:.|..|..|:|     ::
  Rat   341 SSEYYYVGGFYGGC----------NEALMKLELVKHGPMAVAFEV-HDDFLHYHSGIYHHTGLSD 394

  Fly   308 PQCDAQNLDHGVLVVGFGTDE-SGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIAS 364
            |....:..:|.||:||:|.|. :|.|||:||||||:.||:.|:.: :|...::|.|.|
  Rat   395 PFNPFELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGYFR-IRRGTDECAIES 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 10/72 (14%)
Peptidase_C1 154..370 CDD:278538 80/243 (33%)
CtscNP_058793.1 CathepsinC_exc 25..138 CDD:400909 5/25 (20%)
Pox_I6 168..>204 CDD:333259 8/56 (14%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 80/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.