DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and Ctsz

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_899159.1 Gene:Ctsz / 252929 RGDID:708479 Length:306 Species:Rattus norvegicus


Alignment Length:249 Identity:88/249 - (35%)
Similarity:127/249 - (51%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FISPAHVTLPKSVDWRTKGAV---TAVKDQ---GHCGSCWAFSSTGALEGQ-HFRKSGVLVS--L 201
            ::|||  .|||:.|||....|   :..::|   .:||||||..||.||..: :.::.|...|  |
  Rat    58 YLSPA--DLPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLL 120

  Fly   202 SEQNLVDCSTKYGNNG-CNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSC-HFNK-GTVGA--- 260
            |.||::||    ||.| |.||.....:.|...: ||..|....|:|.|..| .||: ||...   
  Rat   121 SVQNVIDC----GNAGSCEGGNDLPVWEYAHKH-GIPDETCNNYQAKDQECDKFNQCGTCTEFKE 180

  Fly   261 --TDRGFTDIPQGD-------EKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLD 316
              |.:.:|....||       ||.|||..|. ||:|..|.|: |....|:.|:|.|.|..| .::
  Rat   181 CHTIQNYTLWRVGDYGSLSGREKMMAEIYAN-GPISCGIMAT-ERMSNYTGGIYTEYQNQA-IIN 242

  Fly   317 HGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPL 370
            |.:.|.|:|....|.:||:|:||||..||::|:::::.:....   .:.|||.|
  Rat   243 HIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKG---GTGSSYNL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853
Peptidase_C1 154..370 CDD:278538 84/239 (35%)
CtszNP_899159.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 85/241 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.