DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and BC051665

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_954599.2 Gene:BC051665 / 218275 MGIID:2682300 Length:330 Species:Mus musculus


Alignment Length:344 Identity:169/344 - (49%)
Similarity:213/344 - (61%) Gaps:17/344 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MRTAVLLPLLALLAVAQAVSF---ADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAK 92
            |....||..|.|..|:.|.:.   .|.|.|||   |.:|||.| :..||..:..::..|...|..
Mouse     1 MTPVFLLATLCLGVVSAAPAHDPSLDAVWEEW---KTKHRKTY-NMNEEAQKRAVWENNMKMIGL 61

  Fly    93 HNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKS 157
            ||:.:.:||..|.|.:|.:.||.:.|||:||.||....||::....|...|         .:|||
Mouse    62 HNEDYLKGKHGFNLEMNAFGDLTNTEFRELMTGFQSMGHKEMTIFQEPLLG---------DVPKS 117

  Fly   158 VDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGL 222
            ||||..|.||.||||||||||||||:.|:||||.|||:|.||.||||||:|||..|||.||||||
Mouse   118 VDWRDHGYVTPVKDQGHCGSCWAFSAVGSLEGQIFRKTGKLVPLSEQNLMDCSWSYGNVGCNGGL 182

  Fly   223 MDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVS 287
            |:.||:|:|:|.|:||.:||.|||.|..|.::.........||..:|..::..| .|||:|||||
Mouse   183 MELAFQYVKENRGLDTRESYAYEAWDGPCRYDPKYSAVNITGFVKVPLSEDALM-NAVASVGPVS 246

  Fly   288 VAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKM 352
            |.||..|.||:||..|.|.||.|.:.||||.|||||:|.:..|..|||||||||..||..|:|||
Mouse   247 VGIDTHHHSFRFYRGGTYYEPDCSSTNLDHAVLVVGYGEESDGRKYWLVKNSWGEDWGMDGYIKM 311

  Fly   353 LRNKENQCGIASASSYPLV 371
            .::::|.||||:.:.||.|
Mouse   312 AKDRDNNCGIATYAIYPTV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 19/58 (33%)
Peptidase_C1 154..370 CDD:278538 126/215 (59%)
BC051665NP_954599.2 PTZ00203 7..326 CDD:185513 164/332 (49%)
Inhibitor_I29 29..87 CDD:214853 21/61 (34%)
Peptidase_C1 114..329 CDD:278538 126/215 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 303 1.000 Domainoid score I1389
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 366 1.000 Inparanoid score I2141
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 1 1.000 - - FOG0000114
OrthoInspector 1 1.000 - - otm42924
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X64
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.