DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and Y40H7A.10

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_502836.1 Gene:Y40H7A.10 / 189809 WormBaseID:WBGene00012747 Length:343 Species:Caenorhabditis elegans


Alignment Length:343 Identity:105/343 - (30%)
Similarity:172/343 - (50%) Gaps:47/343 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LLPLLALLAVAQAVSFADVVMEEWH-------------TFKLEHRKNYQDETEERFRLKIFNENK 87
            |||       :..:|..|.:::..|             .|.:::.:.|.:|.|...|..||:.|.
 Worm    22 LLP-------SYQISDLDQILQRHHIPTPDVKYTNAFQNFLVKYLREYPNEYEIVKRFTIFSRNL 79

  Fly    88 HKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHV 152
            ..:.::|:..| |||:::|  |.::||...|:::      |.:..:...:::|.|..|.|...: 
 Worm    80 DLVERYNKEDA-GKVTYEL--NDFSDLTEEEWKK------YLMTPKPDHSEKSLKPKTLIDKKN- 134

  Fly   153 TLPKSVDWRTKGA---VTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYG 214
             ||.|||||....   ||.:|.||.|||||||::..|:|.......|.|.|||.|.|:||:..  
 Worm   135 -LPNSVDWRNVNGTNHVTGIKYQGPCGSCWAFATAAAIESAVSISGGGLQSLSSQQLLDCTVV-- 196

  Fly   215 NNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEA 279
            ::.|.||....|.:|.:.: ||.|..:|||......|   :.||....|..:.:....|.:||:.
 Worm   197 SDKCGGGEPVEALKYAQSH-GITTAHNYPYYFWTTKC---RETVPTVARISSWMKAESEDEMAQI 257

  Fly   280 VATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTW 344
            ||..||:.|..:.:....:||..|:..:|.|..:. .|.::|:|:     |.|||::||::...|
 Worm   258 VALNGPMIVCANFATNKNRFYHSGIAEDPDCGTEP-THALIVIGY-----GPDYWILKNTYSKVW 316

  Fly   345 GDKGFIKMLRNKENQCGI 362
            |:||::::.|: .|.|||
 Worm   317 GEKGYMRVKRD-VNWCGI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 18/71 (25%)
Peptidase_C1 154..370 CDD:278538 76/212 (36%)
Y40H7A.10NP_502836.1 Inhibitor_I29 51..108 CDD:285458 17/59 (29%)
Peptidase_C1A 136..336 CDD:239068 75/211 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.