DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and cpr-2

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_507186.3 Gene:cpr-2 / 185355 WormBaseID:WBGene00000782 Length:326 Species:Caenorhabditis elegans


Alignment Length:274 Identity:73/274 - (26%)
Similarity:116/274 - (42%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTK----GAVTAVKDQGHCGSCWA 180
            |.:...||.....:.||.:..     |:..|   .|.:.|.||:    .::..:::|.:||||||
 Worm    57 RSMHEKFNAPFPDEFRATERE-----FVLDA---TPLNFDARTRWPQCKSMKLIREQSNCGSCWA 113

  Fly   181 FSSTGALEGQHFRKSGVLVS--LSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTE---- 239
            ||:...:..:....|.....  :|..:|:.|.......||:||....||::....|.:...    
 Worm   114 FSTAEVISDRTCIASNGTQQPIISPTDLLTCCGMSCGEGCDGGFPYRAFQWWARRGVVTGGDYLG 178

  Fly   240 ---KSYPYEAIDD-------------SCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATV---GP 285
               |.||....:.             ||.....|....|:.:.:......:.:|...|.:   ||
 Worm   179 TGCKPYPIRPCNSDNCVNLQTPPCRLSCQPGYRTTYTNDKNYGNSAYPVPRTVAAIQADIYYNGP 243

  Fly   286 VSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFI 350
            | ||....:|.|:.|..|:|......::. .|.|.::|:|| |.|..|||..||||:.||:.|..
 Worm   244 V-VAAFIVYEDFEKYKSGIYRHIAGRSKG-GHAVKLIGWGT-ERGTPYWLAVNSWGSQWGESGTF 305

  Fly   351 KMLRNKENQCGIAS 364
            ::||..: :|||.|
 Worm   306 RILRGVD-ECGIES 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853
Peptidase_C1 154..370 CDD:278538 66/240 (28%)
cpr-2NP_507186.3 Peptidase_C1A_CathepsinB 84..323 CDD:239111 66/239 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.