DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and F15D4.4

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_496805.3 Gene:F15D4.4 / 184530 WormBaseID:WBGene00008861 Length:608 Species:Caenorhabditis elegans


Alignment Length:318 Identity:91/318 - (28%)
Similarity:148/318 - (46%) Gaps:64/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NYQDETEERF-RLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHK 132
            |:....:|.. |..::::.|.::.:||..:..|..|:|::.|:::..|..|...|      ||:.
 Worm   143 NFNSTAKEGLKRFNVYSKVKKEVDEHNIMYELGMSSYKMSTNQFSVALDGEVAPL------TLNL 201

  Fly   133 QLRAADESFKGVTFISPAHVTLPK------SVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEG-- 189
                  ::......:.||.::..|      :||||.  .:..:.||..||.|||||....:|.  
 Worm   202 ------DALTPTATVIPATISSRKKRDTEPTVDWRP--FLKPILDQSTCGGCWAFSMISMIESFF 258

  Fly   190 --QHFRKSGVLVSLSEQNLVDCSTK----YG--NNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEA 246
              |.:..|    |||.|.|:.|.||    ||  |.||.||....|..|::.:...|. ...|::.
 Worm   259 AIQGYNTS----SLSVQQLLTCDTKVDSTYGLANVGCKGGYFQIAGSYLEVSAARDA-SLIPFDL 318

  Fly   247 IDDSCH-------------FNKGTVGA--TDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHES 296
            .|.||.             |:.|.:..  |......:.|..|.|:.:     ||::|.:.|..:.
 Worm   319 EDTSCDSSFFPPVVPTILLFDDGYISGNFTAAQLITMEQNIEDKVRK-----GPIAVGMAAGPDI 378

  Fly   297 FQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLR 354
            :: |||||| :..| ...::|.|::||| ||    |||:::||||.:||:.|:.::.|
 Worm   379 YK-YSEGVY-DGDC-GTIINHAVVIVGF-TD----DYWIIRNSWGASWGEAGYFRVKR 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 11/49 (22%)
Peptidase_C1 154..370 CDD:278538 74/232 (32%)
F15D4.4NP_496805.3 Inhibitor_I29 <146..187 CDD:214853 9/40 (23%)
Peptidase_C1A 227..442 CDD:239068 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.