DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CTSZ

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001327.2 Gene:CTSZ / 1522 HGNCID:2547 Length:303 Species:Homo sapiens


Alignment Length:236 Identity:86/236 - (36%)
Similarity:124/236 - (52%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FISPAHVTLPKSVDWRTKGAV---TAVKDQ---GHCGSCWAFSSTGALEGQ-HFRKSGVLVS--L 201
            ::|||  .||||.|||....|   :..::|   .:||||||.:||.|:..: :.::.|...|  |
Human    56 YLSPA--DLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLL 118

  Fly   202 SEQNLVDCSTKYGNNG-CNGG----LMDNAFRYIKDNGGIDTEKSYPYEAIDDSC-HFNK-GTVG 259
            |.||::||    ||.| |.||    :.|.|.::     ||..|....|:|.|..| .||: ||..
Human   119 SVQNVIDC----GNAGSCEGGNDLSVWDYAHQH-----GIPDETCNNYQAKDQECDKFNQCGTCN 174

  Fly   260 A-----TDRGFTDIPQGD-------EKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDA 312
            .     ..|.:|....||       ||.|||..|. ||:|..|.|: |....|:.|:|.|.| |.
Human   175 EFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYAN-GPISCGIMAT-ERLANYTGGIYAEYQ-DT 236

  Fly   313 QNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKML 353
            ..::|.|.|.|:|..: |.:||:|:||||..||::|:::::
Human   237 TYINHVVSVAGWGISD-GTEYWIVRNSWGEPWGERGWLRIV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853
Peptidase_C1 154..370 CDD:278538 83/228 (36%)
CTSZNP_001327.2 Peptidase_C1A_CathepsinX 62..302 CDD:239149 83/228 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.