DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CTSS

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_004070.3 Gene:CTSS / 1520 HGNCID:2545 Length:331 Species:Homo sapiens


Alignment Length:341 Identity:164/341 - (48%)
Similarity:213/341 - (62%) Gaps:14/341 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MRTAVLLPLLALLAVAQAVSFADVVME-EWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHN 94
            |:..|.:.|:...||||.  ..|..:: .||.:|..:.|.|:::.||..|..|:.:|...:..||
Human     1 MKRLVCVLLVCSSAVAQL--HKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHN 63

  Fly    95 QRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVD 159
            ...:.|..|:.|.:|...|:...|...||:        .||...:..:.:|:.|..:..||.|||
Human    64 LEHSMGMHSYDLGMNHLGDMTSEEVMSLMS--------SLRVPSQWQRNITYKSNPNRILPDSVD 120

  Fly   160 WRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCST-KYGNNGCNGGLM 223
            ||.||.||.||.||.||:|||||:.||||.|...|:|.|||||.|||||||| ||||.|||||.|
Human   121 WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFM 185

  Fly   224 DNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSV 288
            ..||:||.||.|||::.||||:|:|..|.::.....||...:|::|.|.|..:.||||..|||||
Human   186 TTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSV 250

  Fly   289 AIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKML 353
            .:||.|.||..|..|||.||.| .||::|||||||:| |.:|::|||||||||..:|::|:|:|.
Human   251 GVDARHPSFFLYRSGVYYEPSC-TQNVNHGVLVVGYG-DLNGKEYWLVKNSWGHNFGEEGYIRMA 313

  Fly   354 RNKENQCGIASASSYP 369
            |||.|.|||||..|||
Human   314 RNKGNHCGIASFPSYP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 17/58 (29%)
Peptidase_C1 154..370 CDD:278538 132/217 (61%)
CTSSNP_004070.3 PTZ00203 5..326 CDD:185513 160/332 (48%)
Inhibitor_I29 28..87 CDD:214853 17/58 (29%)
Peptidase_C1 115..329 CDD:278538 130/215 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 1 1.000 - - FOG0000114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X64
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.