DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CTSK

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_000387.1 Gene:CTSK / 1513 HGNCID:2536 Length:329 Species:Homo sapiens


Alignment Length:339 Identity:156/339 - (46%)
Similarity:213/339 - (62%) Gaps:22/339 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VLLPLLALLAVAQAVSFA----DVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQ 95
            :|||:         ||||    :::...|..:|..|||.|.::.:|..|..|:.:|...|:.||.
Human     7 LLLPV---------VSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNL 62

  Fly    96 RFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDW 160
            ..:.|..:::||:|...|:...|..|.|.|....| ...|:.|     ..:|.......|.|||:
Human    63 EASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPL-SHSRSND-----TLYIPEWEGRAPDSVDY 121

  Fly   161 RTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDN 225
            |.||.||.||:||.|||||||||.||||||..:|:|.|::||.||||||.::  |:||.||.|.|
Human   122 RKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSE--NDGCGGGYMTN 184

  Fly   226 AFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAI 290
            ||:|::.|.|||:|.:|||...::||.:|.....|..||:.:||:|:||.:..|||.||||||||
Human   185 AFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAI 249

  Fly   291 DASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRN 355
            |||..||||||:|||.:..|::.||:|.||.||:|. :.|..:|::|||||..||:||:|.|.||
Human   250 DASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGI-QKGNKHWIIKNSWGENWGNKGYILMARN 313

  Fly   356 KENQCGIASASSYP 369
            |.|.||||:.:|:|
Human   314 KNNACGIANLASFP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 18/58 (31%)
Peptidase_C1 154..370 CDD:278538 123/216 (57%)
CTSKNP_000387.1 Inhibitor_I29 26..85 CDD:214853 18/58 (31%)
Peptidase_C1 115..327 CDD:306594 122/214 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 1 1.000 - - FOG0000114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X64
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.