DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and CTSH

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_004381.2 Gene:CTSH / 1512 HGNCID:2535 Length:335 Species:Homo sapiens


Alignment Length:345 Identity:131/345 - (37%)
Similarity:188/345 - (54%) Gaps:28/345 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPLLAL------LAVAQAVSFADVVMEEWH--TFKLEHRKNYQDETEERFRLKIFNENKHKIAKH 93
            ||||..      :.|..|.......:|::|  ::..:|||.|..| |...||:.|..|..||..|
Human     5 LPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTE-EYHHRLQTFASNWRKINAH 68

  Fly    94 NQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSV 158
            |    .|..:||:|:|:::|:   .|.::.:.:.::..:...|...::...|  .|    .|.||
Human    69 N----NGNHTFKMALNQFSDM---SFAEIKHKYLWSEPQNCSATKSNYLRGT--GP----YPPSV 120

  Fly   159 DWRTKG-AVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGL 222
            |||.|| .|:.||:||.|||||.||:|||||......:|.::||:||.||||:..:.|:||.|||
Human   121 DWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGL 185

  Fly   223 MDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVS 287
            ...||.||..|.||..|.:|||:..|..|.|..|......:...:|...||:.|.||||...|||
Human   186 PSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVS 250

  Fly   288 VAIDASHESFQFYSEGVYNEPQC--DAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFI 350
            .|.:.: :.|..|..|:|:...|  ....::|.||.||:| :::|..||:||||||..||..|:.
Human   251 FAFEVT-QDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYG-EKNGIPYWIVKNSWGPQWGMNGYF 313

  Fly   351 KMLRNKENQCGIASASSYPL 370
            .:.|.| |.||:|:.:|||:
Human   314 LIERGK-NMCGLAACASYPI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 21/60 (35%)
Peptidase_C1 154..370 CDD:278538 98/218 (45%)
CTSHNP_004381.2 Inhibitor_I29 35..90 CDD:285458 21/62 (34%)
Peptidase_C1 117..332 CDD:278538 98/217 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X64
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.