DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp1 and Ctsk

DIOPT Version :9

Sequence 1:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_031828.2 Gene:Ctsk / 13038 MGIID:107823 Length:329 Species:Mus musculus


Alignment Length:336 Identity:151/336 - (44%)
Similarity:212/336 - (63%) Gaps:16/336 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VLLPLLALLAVAQAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAE 99
            :|||:     |:.|:|..:::..:|..:|..|:|.|..:.:|..|..|:.:|..:|:.||...:.
Mouse     7 LLLPM-----VSFALSPEEMLDTQWELWKKTHQKQYNSKVDEISRRLIWEKNLKQISAHNLEASL 66

  Fly   100 GKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPA-HVTLPKSVDWRTK 163
            |..:::||:|...|:...|..|.|.|...       ....|:...|..:|. ...:|.|:|:|.|
Mouse    67 GVHTYELAMNHLGDMTSEEVVQKMTGLRI-------PPSRSYSNDTLYTPEWEGRVPDSIDYRKK 124

  Fly   164 GAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFR 228
            |.||.||:||.|||||||||.||||||..:|:|.|::||.||||||.|:  |.||.||.|..||:
Mouse   125 GYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTE--NYGCGGGYMTTAFQ 187

  Fly   229 YIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDAS 293
            |::.|||||:|.:|||...|:||.:|.....|..||:.:||.|:||.:..|||.|||:||:||||
Mouse   188 YVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDAS 252

  Fly   294 HESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKEN 358
            ..||||||.|||.:..||..|::|.|||||:|| :.|..:|::|||||.:||:||:..:.|||.|
Mouse   253 LASFQFYSRGVYYDENCDRDNVNHAVLVVGYGT-QKGSKHWIIKNSWGESWGNKGYALLARNKNN 316

  Fly   359 QCGIASASSYP 369
            .|||.:.:|:|
Mouse   317 ACGITNMASFP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 17/58 (29%)
Peptidase_C1 154..370 CDD:278538 121/216 (56%)
CtskNP_031828.2 Inhibitor_I29 26..85 CDD:214853 17/58 (29%)
Peptidase_C1A 116..327 CDD:239068 120/213 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 1 1.000 - - FOG0000114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X64
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.