DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn13 and RPN13

DIOPT Version :9

Sequence 1:NP_001137662.1 Gene:Rpn13 / 36545 FlyBaseID:FBgn0033886 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_013525.3 Gene:RPN13 / 851140 SGDID:S000004413 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:41/145 - (28%)
Similarity:70/145 - (48%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SNSSNLVEFRAG--RMNMVGKMVHPDPRKGLVYMTQSDD---GLMHFCWK--DRTSGKVED--DL 67
            |.||.:::||||  ..|...::..|.|.:|.:.:..:::   |...|.|:  ::..|:..|  .|
Yeast     2 SMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISL 66

  Fly    68 IVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTD---------KDDEQCRRINELLN 123
            |:.|.:..:..:...|:||::.|.| ||..|.|||:||..:.         ||.|...::..:||
Yeast    67 ILIPGETMWVPIKSSKSGRIFALVF-SSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLN 130

  Fly   124 NPPSAHQRGGGGSND 138
            |...:.:.   .|||
Yeast   131 NSSESDEE---ESND 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn13NP_001137662.1 PH_Rpn13 18..122 CDD:270124 32/121 (26%)
RPN13_C 267..376 CDD:293158
RPN13NP_013525.3 Proteasom_Rpn13 13..103 CDD:398384 24/90 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344149
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3037
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102724
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.