powered by:
Protein Alignment Rpn13 and C56G2.9
DIOPT Version :9
Sequence 1: | NP_001137662.1 |
Gene: | Rpn13 / 36545 |
FlyBaseID: | FBgn0033886 |
Length: | 424 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_741189.2 |
Gene: | C56G2.9 / 266886 |
WormBaseID: | WBGene00016982 |
Length: | 176 |
Species: | Caenorhabditis elegans |
Alignment Length: | 114 |
Identity: | 22/114 - (19%) |
Similarity: | 37/114 - (32%) |
Gaps: | 30/114 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 LGQMNSRTPSSRNTSSSGGGGASALQTPENVSVPRTPSAPSKSGSSRSSSNVNSQVGEGAGS--- 231
:.:|.::.|..::...|. |.|..:|:........|...:.||...||....|.||
Worm 46 MSEMETKNPKRKSIKKSD-------QKPSTMSLNVGKGGVEKEKETISSQRSNSLESPGLGSPQN 103
Fly 232 ----------------SVDADA----PGKNSTTSTTTASKSTGAYANPF 260
.:..|: .||..|..:..:..|.|:.:.||
Worm 104 VGLGIFEAATMMRNIVDITTDSTTMKTGKTKTLKSKESKTSLGSASGPF 152
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rpn13 | NP_001137662.1 |
PH_Rpn13 |
18..122 |
CDD:270124 |
|
RPN13_C |
267..376 |
CDD:293158 |
|
C56G2.9 | NP_741189.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3037 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.