DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn13 and C56G2.9

DIOPT Version :9

Sequence 1:NP_001137662.1 Gene:Rpn13 / 36545 FlyBaseID:FBgn0033886 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_741189.2 Gene:C56G2.9 / 266886 WormBaseID:WBGene00016982 Length:176 Species:Caenorhabditis elegans


Alignment Length:114 Identity:22/114 - (19%)
Similarity:37/114 - (32%) Gaps:30/114 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LGQMNSRTPSSRNTSSSGGGGASALQTPENVSVPRTPSAPSKSGSSRSSSNVNSQVGEGAGS--- 231
            :.:|.::.|..::...|.       |.|..:|:........|...:.||...||....|.||   
 Worm    46 MSEMETKNPKRKSIKKSD-------QKPSTMSLNVGKGGVEKEKETISSQRSNSLESPGLGSPQN 103

  Fly   232 ----------------SVDADA----PGKNSTTSTTTASKSTGAYANPF 260
                            .:..|:    .||..|..:..:..|.|:.:.||
 Worm   104 VGLGIFEAATMMRNIVDITTDSTTMKTGKTKTLKSKESKTSLGSASGPF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn13NP_001137662.1 PH_Rpn13 18..122 CDD:270124
RPN13_C 267..376 CDD:293158
C56G2.9NP_741189.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.