DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AGO1 and CG43373

DIOPT Version :9

Sequence 1:NP_001246314.1 Gene:AGO1 / 36544 FlyBaseID:FBgn0262739 Length:984 Species:Drosophila melanogaster
Sequence 2:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster


Alignment Length:413 Identity:80/413 - (19%)
Similarity:130/413 - (31%) Gaps:114/413 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 ITHCGQMRRKYRV-----CNVTRRPAQMQSFPLQLENGQTVE----CTVAKYFLDKYRMKLRYPH 433
            |.|..|....||:     ...|.....|:.  ||..|.:.:|    ..||::||.      |..|
  Fly  1225 IFHSHQTEATYRLDFIWKLQATEEKEDMEH--LQAYNRKLLENILPVHVAEHFLS------REKH 1281

  Fly   434 LPCLQVGQ------------EHKHTYLPLEVCNIVAGQRCIKKLTDM-------------QTSTM 473
            |..|...|            .....|:.||..|  .|..|::.|.::             :....
  Fly  1282 LDDLYHEQCDSVCILFASIPNFSEFYVELEGNN--EGVECLRLLNEIIADFDELLSEERFRCIEK 1344

  Fly   474 IKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYG---GRVST 535
            ||:|..:.........|...|.:|::.:.:.::.|.:.:.:.||........:::.|   |.|..
  Fly  1345 IKSTGATYMAASGLTANTCDRVNFSHVTAMADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVA 1409

  Fly   536 GLTGQQLFPPQNKVSLASPNQGVW----DMRGKQFFTGVEIRIWAIACFAPQRTVREDALRNFTQ 596
            |:.|           ...|...:|    ::..:...||:...|                  ..||
  Fly  1410 GVIG-----------ACKPQYDIWGNAVNVASRMDSTGLVDHI------------------QVTQ 1445

  Fly   597 QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRY-LK----ITFPGLQLV-VVVLPGKTPVYAE 655
            ::|:|....|..:.     |:.:........|..| ||    |....|:|. ..|.|.||...|:
  Fly  1446 EMQQILEGRGFELT-----CRGSVDVKGKGSMITYFLKGRRPIDAKELELAKTEVEPPKTLTLAK 1505

  Fly   656 VKRVGDTVLGMATQCVQAK---------------------NVNKTSPQTLSNLCLKINVKLG-GI 698
            .....|:......|..|.|                     |:...:.|...:||.:.|:... |.
  Fly  1506 EPEKLDSGTATEKQREQVKEQGSTEQEDDLLPSPDIDMNSNMQNLTAQRRKSLCRQHNISSSFGT 1570

  Fly   699 NSILVPSIRPKVFN-EPVIFLGA 720
            .......|.|.:.| ..|:.:||
  Fly  1571 TVSSSTGITPSISNSSSVVTIGA 1593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AGO1NP_001246314.1 ArgoN 146..275 CDD:406799
ArgoL1 285..335 CDD:400854
PAZ_argonaute_like 336..456 CDD:239212 24/98 (24%)
Piwi_ago-like 502..942 CDD:240015 47/255 (18%)
CG43373NP_001097622.2 AC_N <523..720 CDD:292831
CYCc 686..881 CDD:214485
Guanylate_cyc 722..895 CDD:278633
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485 41/232 (18%)
Guanylate_cyc 1285..1479 CDD:278633 37/229 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.