DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AGO1 and R06C7.2

DIOPT Version :9

Sequence 1:NP_001246314.1 Gene:AGO1 / 36544 FlyBaseID:FBgn0262739 Length:984 Species:Drosophila melanogaster
Sequence 2:NP_492044.2 Gene:R06C7.2 / 187640 WormBaseID:WBGene00011062 Length:233 Species:Caenorhabditis elegans


Alignment Length:111 Identity:22/111 - (19%)
Similarity:44/111 - (39%) Gaps:31/111 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 FHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINE-QRKPLTDSQRVKFTKEIKGL 374
            ||...:.....:||. |.:|....:.|   :..|::..:.:..| .||.|.|::|.  .|:::.|
 Worm    50 FHAEEKVLFQSVMLK-DQTAKTEKRTQ---EITCQLSKLANFEENNRKKLQDTERE--NKKLRNL 108

  Fly   375 KIEITHCGQMRRKYRVCNVTRRPAQMQSFPLQL------ENGQTVE 414
                              :.....::::.|||:      ||.:.:|
 Worm   109 ------------------INSLELKLENLPLQILFFLISENDELLE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AGO1NP_001246314.1 ArgoN 146..275 CDD:406799
ArgoL1 285..335 CDD:400854 6/23 (26%)
PAZ_argonaute_like 336..456 CDD:239212 16/86 (19%)
Piwi_ago-like 502..942 CDD:240015
R06C7.2NP_492044.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.