DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and HSP31

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_010822.1 Gene:HSP31 / 852146 SGDID:S000002941 Length:237 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:31/145 - (21%)
Similarity:51/145 - (35%) Gaps:38/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VTRGDYDVVVLPGGLAGNKALMN---SSAVGDVLRCQESKGGLIAAICAAPT---ALAKHGIGK- 146
            |...||.:..   ..||:..|.:   :..:.|:.....:.||::||:|..|.   .|.....|: 
Yeast    94 VNADDYQIFF---ASAGHGTLFDYPKAKDLQDIASEIYANGGVVAAVCHGPAIFDGLTDKKTGRP 155

  Fly   147 ---GKSITSHPDMKPQL---------KELYCYID----------------DKTVVQDGNIITSRG 183
               |||||...|:...:         |.|....|                |...:.||.::|...
Yeast   156 LIEGKSITGFTDVGETILGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVN 220

  Fly   184 PGTTFDFALKITEQL 198
            |.:....|::..:.|
Yeast   221 PASAHSTAVRSIDAL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 31/145 (21%)
HSP31NP_010822.1 GATase1_Ydr533c_like 5..235 CDD:153241 30/143 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.