DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and DJ1C

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_195128.2 Gene:DJ1C / 829548 AraportID:AT4G34020 Length:472 Species:Arabidopsis thaliana


Alignment Length:225 Identity:69/225 - (30%)
Similarity:107/225 - (47%) Gaps:31/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLRKSFPN-----------GVTHAHRVIRCKSNQDKCAKNALIILAPGAEEMEFTISADVLRRGK 57
            :||..:.|           .:.|..||              ||.:|.|:|.:|....||||||.|
plant   263 LLRDGYQNPKNKEFNSIDWSLDHTPRV--------------LIPVANGSEAVELVSIADVLRRAK 313

  Fly    58 ILVTVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGDYDVVVLPGGLAGNKALMNSSAVGDVLRCQ 122
            :.|||:.:.....:...:...|:.|..:.|| ....||:::||||..|::.|..|..:..:||.|
plant   314 VDVTVSSVERSLRITAFQGTKIITDKLIGEA-AESSYDLIILPGGHTGSERLQKSKILKKLLREQ 377

  Fly   123 ESKGGLIAAICAAPTALAKHGIGKGKSITSHPDM--KPQLKELYCYIDDKTVVQDGNIITSRGPG 185
            ...|.:..|..::.|.|.|||:.|.|..|.:|..  :|..:::   |:...||.|||:|||.|..
plant   378 HESGRIYGATNSSSTVLHKHGLLKEKRTTVYPSESDEPMNQQM---IEGAEVVIDGNVITSLGLA 439

  Fly   186 TTFDFALKITEQLVGAEVAKEVAKAMLWTY 215
            |...|:|.|..:|.|...|:.|::.::..|
plant   440 TVTKFSLAIVSKLFGHARARSVSEGLVHEY 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 62/178 (35%)
DJ1CNP_195128.2 DJ-1_PfpI 84..248 CDD:280192
not_thiJ 85..258 CDD:213612
not_thiJ 288..464 CDD:213612 64/193 (33%)
GATase1_DJ-1 289..452 CDD:153229 59/180 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 125 1.000 Domainoid score I1789
eggNOG 1 0.900 - - E1_COG0693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - mtm1166
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - O PTHR48094
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.