DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and DJ1F

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_191023.1 Gene:DJ1F / 824625 AraportID:AT3G54600 Length:399 Species:Arabidopsis thaliana


Alignment Length:133 Identity:41/133 - (30%)
Similarity:59/133 - (44%) Gaps:20/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RRGKILVTVAGLHDCE-----PV-KCSRSVVIVPDTSLEEAVTRGDYDVVVLPGGLAGNKALMNS 112
            :||:...|:  :||.|     |. |...:..:   |...:.|:..|||.:|:|||.:....:||.
plant   248 KRGEKCATI--VHDLEDGRQLPTEKFGHNFYV---TVAWDDVSVDDYDCIVVPGGRSPELLVMNP 307

  Fly   113 SAVGDVLRCQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQLK----ELY----CYIDD 169
            .|| :::|....||..:|||......||..|..|.|...|....|..:|    |:.    |..||
plant   308 KAV-ELVRKFVEKGKFVAAIGMGNWLLAATGALKKKRCASSYGTKVAVKVAGGEIVESERCVTDD 371

  Fly   170 KTV 172
            |.|
plant   372 KLV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 41/133 (31%)
DJ1FNP_191023.1 GATase1_PfpI_1 8..198 CDD:153243
GATase1_PfpI_1 212..393 CDD:153243 41/133 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.