DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and Park7

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_065594.2 Gene:Park7 / 57320 MGIID:2135637 Length:189 Species:Mus musculus


Alignment Length:185 Identity:103/185 - (55%)
Similarity:130/185 - (70%) Gaps:4/185 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKNALIILAPGAEEMEFTISADVLRRGKILVTVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGDY 94
            :|.||:|||.||||||..|..||:||..|.||||||...:||:|||.|:|.||||||:|.|:|.|
Mouse     3 SKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPY 67

  Fly    95 DVVVLPGGLAGNKALMNSSAVGDVLRCQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQ 159
            ||||||||..|.:.|..|..|.::|:.|||:.||||||||.||||..|.:|.|..:|:||..|.:
Mouse    68 DVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHPLAKDK 132

  Fly   160 LK--ELYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAML 212
            :.  ..|.|.:.: |.:||.|:|||||||:|:|||.|.|.|||.::|.:| ||.|
Mouse   133 MMNGSHYSYSESR-VEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQV-KAPL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 99/178 (56%)
Park7NP_065594.2 not_thiJ 5..184 CDD:213612 100/180 (56%)
GATase1_DJ-1 6..172 CDD:153229 94/166 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837971
Domainoid 1 1.000 171 1.000 Domainoid score I3729
eggNOG 1 0.900 - - E1_COG0693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54253
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm44207
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - O PTHR48094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.