DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and park7

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001015851.1 Gene:park7 / 548568 XenbaseID:XB-GENE-1005316 Length:189 Species:Xenopus tropicalis


Alignment Length:184 Identity:109/184 - (59%)
Similarity:133/184 - (72%) Gaps:3/184 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KNALIILAPGAEEMEFTISADVLRRGKILVTVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGDYD 95
            |.||:|||.||||||..|.|||:||..|.||:|||...:||.|||.||:.||||||||.|:|.||
 Frog     4 KRALLILAKGAEEMETVIPADVMRRAGIKVTIAGLSGKDPVLCSRDVVLCPDTSLEEARTQGPYD 68

  Fly    96 VVVLPGGLAGNKALMNSSAVGDVLRCQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQL 160
            |||||||..|.:.|..|..|.:||:.||:|.||||||||.||||..||:|.||:||:||..|.::
 Frog    69 VVVLPGGNLGAQNLSESPVVKEVLKEQEAKNGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKI 133

  Fly   161 --KELYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAML 212
              .:.|.|.::: ||:|||.||||||||:|:|||.|...|||.|||.:|...:|
 Frog   134 VNADHYKYSEER-VVKDGNFITSRGPGTSFEFALMIVSTLVGKEVADQVKSPLL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 107/178 (60%)
park7NP_001015851.1 GAT_1 5..184 CDD:412116 107/179 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3325
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 198 1.000 Inparanoid score I3681
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm49379
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.