DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and park7

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001005938.1 Gene:park7 / 449674 ZFINID:ZDB-GENE-041010-5 Length:189 Species:Danio rerio


Alignment Length:184 Identity:107/184 - (58%)
Similarity:133/184 - (72%) Gaps:4/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KNALIILAPGAEEMEFTISADVLRRGKILVTVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGDYD 95
            |.||:|||.||||||..|..||:||..|.||||||...|||:|||.|:|.||:|||:|..:|.||
Zfish     4 KRALVILAKGAEEMETVIPVDVMRRAGIAVTVAGLAGKEPVQCSREVMICPDSSLEDAHKQGPYD 68

  Fly    96 VVVLPGGLAGNKALMNSSAVGDVLRCQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQL 160
            ||:|||||.|.:.|..|.||.:||:.||.:.||||||||.||||..|||..|.::|:||..|.::
Zfish    69 VVLLPGGLLGAQNLSESPAVKEVLKDQEGRKGLIAAICAGPTALLAHGIAYGSTVTTHPGAKDKM 133

  Fly   161 K--ELYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAML 212
            .  :.|.| .:..|.:|||:||||||||:|:|||.|.|:|:|||||.:| ||.|
Zfish   134 MAGDHYKY-SEARVQKDGNVITSRGPGTSFEFALTIVEELMGAEVAAQV-KAPL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 103/178 (58%)
park7NP_001005938.1 not_thiJ 5..184 CDD:213612 104/180 (58%)
GATase1_DJ-1 6..172 CDD:153229 96/166 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581768
Domainoid 1 1.000 180 1.000 Domainoid score I3462
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 193 1.000 Inparanoid score I3838
OMA 1 1.010 - - QHG54253
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm24608
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - O PTHR48094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.