DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and dj-1beta

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster


Alignment Length:186 Identity:125/186 - (67%)
Similarity:147/186 - (79%) Gaps:1/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKNALIILAPGAEEMEFTISADVLRRGKILVTVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGDY 94
            :|:||:|||||||||||.|:||||||..|.||||||:..|.|||||.|.|:|||||.: |....:
  Fly     2 SKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQ-VASDKF 65

  Fly    95 DVVVLPGGLAGNKALMNSSAVGDVLRCQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQ 159
            |||||||||.|:.|:..||.|||:||.|||.||||||||||||.|||||:..|||:||:|.||||
  Fly    66 DVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQ 130

  Fly   160 LKELYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAMLWTY 215
            |...|.|:||||||:|||:||||||||.::|||||.|:|.|.|..:||||.:|..|
  Fly   131 LVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLVAY 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 121/176 (69%)
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 121/177 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450105
Domainoid 1 1.000 125 1.000 Domainoid score I1789
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 193 1.000 Inparanoid score I3838
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54253
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm24608
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - P PTHR48094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 1 1.000 - - X2164
1312.940

Return to query results.
Submit another query.