DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and SPAC22E12.03c

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_594829.1 Gene:SPAC22E12.03c / 2541772 PomBaseID:SPAC22E12.03c Length:191 Species:Schizosaccharomyces pombe


Alignment Length:185 Identity:60/185 - (32%)
Similarity:95/185 - (51%) Gaps:10/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IILAPGAEEMEFTISADVLRRGKILV--TVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGD---- 93
            :.:|.|.:|:||:....:.:|.:|.:  ...|.:....||.||.|.:..:.|.:|..:..|    
pombe     6 LFVADGTDEIEFSAPWGIFKRAEIPIDSVYVGENKDRLVKMSRDVEMYANRSYKEIPSADDFAKQ 70

  Fly    94 YDVVVLPGGLAGNKALMNSSAVGDVLR-CQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMK 157
            ||:.::|||..|.|.|..:..|..|:: ..:.....|..|||. |..||......|.||.||.::
pombe    71 YDIAIIPGGGLGAKTLSTTPFVQQVVKEFYKKPNKWIGMICAG-TLTAKTSGLPNKQITGHPSVR 134

  Fly   158 PQLKE-LYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAM 211
            .||:| .|.|:|...|::: |:|||:||||...|.||:.||:...:....|.|::
pombe   135 GQLEEGGYKYLDQPVVLEE-NLITSQGPGTAMLFGLKLLEQVASKDKYNAVYKSL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 59/182 (32%)
SPAC22E12.03cNP_594829.1 DJ-1_PfpI 2..174 CDD:280192 56/169 (33%)
not_thiJ 3..186 CDD:213612 59/181 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2310
eggNOG 1 0.900 - - E1_COG0693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 92 1.000 Inparanoid score I1729
OMA 1 1.010 - - QHG54253
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm47400
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - O PTHR48094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.