DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and SPAC1F7.06

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_594492.1 Gene:SPAC1F7.06 / 2541687 PomBaseID:SPAC1F7.06 Length:251 Species:Schizosaccharomyces pombe


Alignment Length:181 Identity:40/181 - (22%)
Similarity:69/181 - (38%) Gaps:56/181 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SRSVVIVPDTSLE---------EAVTRGDYDVVVLPGGLAGNKALMNSSAVGDVL-RCQESKGGL 128
            ::|:...||.||.         :.:...||.:|.:|||...:....::..|.|.| |..|:| |:
pombe    81 TQSIFSNPDCSLMKKLKNIARLDRLNPSDYVIVYIPGGYGCSFDFPHAKVVQDFLYRFYETK-GI 144

  Fly   129 IAAICAAPTALAKHGIGKGKSITSHPDM-----KPQLK----------ELY-------------- 164
            |.|:..|..|||......|:::.::..:     |.:::          ..|              
pombe   145 ICAVAQANIALAYTTNSDGQALCTNRRVTGCTWKDEVQNGVLNVMNRLNFYSFGHIAENIGAIFE 209

  Fly   165 ---CYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAML 212
               .|::|..:|:||.:.|...           |....|  ||.|..:|:|
pombe   210 SPPVYVEDPFIVEDGQLFTGSN-----------TNSAKG--VAMEAVRAVL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 38/177 (21%)
SPAC1F7.06NP_594492.1 GAT_1 16..246 CDD:294025 38/178 (21%)
ThiJ 34..251 CDD:223765 40/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.