DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DJ-1alpha and Park7

DIOPT Version :9

Sequence 1:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001264178.1 Gene:Park7 / 117287 RGDID:621808 Length:214 Species:Rattus norvegicus


Alignment Length:139 Identity:79/139 - (56%)
Similarity:97/139 - (69%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKNALIILAPGAEEMEFTISADVLRRGKILVTVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGDY 94
            :|.||:|||.||||||..|..|::||..|.||||||...:||:|||.|||.||||||||.|:|.|
  Rat     3 SKRALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQGPY 67

  Fly    95 DVVVLPGGLAGNKALMNSSAVGDVLRCQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQ 159
            ||||||||..|.:.|..|:.|.::|:.||::.||||||||.||||..|.:|.|..:||||..|.:
  Rat    68 DVVVLPGGNLGAQNLSESALVKEILKEQENRKGLIAAICAGPTALLAHEVGFGCKVTSHPLAKDK 132

  Fly   160 LKELYCYID 168
            :....|..|
  Rat   133 MMNGSCSQD 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 78/136 (57%)
Park7NP_001264178.1 GATase1_DJ-1 6..141 CDD:153229 77/134 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341746
Domainoid 1 1.000 174 1.000 Domainoid score I3573
eggNOG 1 0.900 - - E1_COG0693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 183 1.000 Inparanoid score I3864
OMA 1 1.010 - - QHG54253
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm46301
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - O PTHR48094
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.