DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shot and otogl

DIOPT Version :9

Sequence 1:NP_725339.1 Gene:shot / 36542 FlyBaseID:FBgn0013733 Length:8805 Species:Drosophila melanogaster
Sequence 2:XP_021328895.1 Gene:otogl / 555569 ZFINID:ZDB-GENE-050419-93 Length:2556 Species:Danio rerio


Alignment Length:310 Identity:82/310 - (26%)
Similarity:117/310 - (37%) Gaps:77/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  2936 PKEPQTSFIEQERR----KE----LQPQQVPSEVDNLLSETENFISSTTANFIANEKQQDKPDTL 2992
            |:.|:|..:::..|    ||    |.|...|            ::..|.:|     :....|.|.
Zfish  1421 PRCPKTMLLDEVTRRCVYKEDCVMLSPTPTP------------YMFVTRSN-----RTTAAPTTA 1468

  Fly  2993 PQESNLPLEVESTSTLTTTTVTTITTSSTTTETGNLEPVVVED--VSTTVKEDKV-VVKPSTVPE 3054
            |                |||.:|.||.||||.|.:..|.....  :.||..|..| :|.|:|...
Zfish  1469 P----------------TTTTSTTTTPSTTTATPSTAPTTTSSTTIITTPSEAAVLIVSPTTTTL 1517

  Fly  3055 DKTEVSKITETITT---VTSNETDTVPEKIS----QKSASEESAK-KDPVVT-----KDTSSRPA 3106
            ..|.||..|||.:|   .||:...|.|..|:    ..||:..:|| ..|::|     ..|:....
Zfish  1518 PPTTVSSTTETTSTETPTTSSPPTTEPPLITTAPPTTSATPTTAKPTTPIITTLPSSTSTTEMTT 1582

  Fly  3107 ETETSPKPVQKEPTPDPAQNTEFPESIKKDPTPEPDYKETATEAAQITPKEASPAPTNKNEQSAE 3171
            .:|.:.||....||......|.......:..|.|.......||:..::|....|:.|.    :|.
Zfish  1583 SSEATTKPETTSPTTTVQPITTTTVITTESTTLESTTTVITTESTSVSPTTEEPSTTT----AAV 1643

  Fly  3172 PTS------KPEPMPRTAKKEEISEIEPPFTAPLAPF-------VDQLAE 3208
            ||:      .|.|.|.||   .|:.:.|||..|..|.       ||:.:|
Zfish  1644 PTTSEIIIPSPSPSPETA---GITTVLPPFLLPTGPCTPPYSLRVDECSE 1690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shotNP_725339.1 SAC6 204..>420 CDD:227401
CH 223..327 CDD:306753
SPEC 471..689 CDD:238103
SPEC 690..866 CDD:238103
SH3 885..922 CDD:327375
SPEC 1047..1250 CDD:238103
SPEC 1153..1390 CDD:238103
PLEC <1498..1526 CDD:197605
Plectin 1949..1981 CDD:307019
DNA_pol3_delta2 <2711..3178 CDD:331068 69/271 (25%)
DUF4775 3026..3357 CDD:330579 57/212 (27%)
SMC_N <4904..5566 CDD:330553
SPEC 5304..5513 CDD:238103
SPEC <5658..5787 CDD:321951
SPEC 5793..6007 CDD:238103
SPEC 6011..6220 CDD:238103
SPEC 6118..6330 CDD:238103
PRK09039 <6279..6441 CDD:332967
SPEC 6443..6660 CDD:238103
SPEC 6663..6878 CDD:238103
SPEC 6880..7087 CDD:238103
SPEC 6986..7196 CDD:238103
SPEC 7196..7417 CDD:238103
SPEC 7314..7526 CDD:238103
SPEC 7528..7747 CDD:238103
SPEC 7749..7968 CDD:238103
SPEC 7973..8181 CDD:238103
EF-hand_7 8373..8437 CDD:316058
GAS2 8450..8522 CDD:128539
Herpes_ICP4_C 8550..>8795 CDD:332854
otoglXP_021328895.1 VWD 121..261 CDD:214566
C8 319..381 CDD:312319
TIL 394..442 CDD:307783
VWD 471..636 CDD:214566
C8 679..740 CDD:312319
TIL 747..802 CDD:307783
TIL 845..911 CDD:307783
VWD 951..1097 CDD:306577
C8 1131..1205 CDD:214843
VWD 1729..1901 CDD:214566
C8 1936..2006 CDD:214843
GHB_like 2474..2556 CDD:328788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.