powered by:
Protein Alignment shot and cv-2
DIOPT Version :9
Sequence 1: | NP_725339.1 |
Gene: | shot / 36542 |
FlyBaseID: | FBgn0013733 |
Length: | 8805 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524809.2 |
Gene: | cv-2 / 45280 |
FlyBaseID: | FBgn0000395 |
Length: | 751 |
Species: | Drosophila melanogaster |
Alignment Length: | 37 |
Identity: | 14/37 - (37%) |
Similarity: | 21/37 - (56%) |
Gaps: | 2/37 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 2757 ETVRAVHTVTTKTIELMQGYVLISNNEVQNVNTGEVC 2793
:|.:.|.||.|:||: :.|....||::|....||.|
Fly 144 KTYKCVATVVTETIQ--KCYSQCDNNQLQPPRPGECC 178
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1216 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.