DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shot and CG5984

DIOPT Version :9

Sequence 1:NP_725339.1 Gene:shot / 36542 FlyBaseID:FBgn0013733 Length:8805 Species:Drosophila melanogaster
Sequence 2:NP_651548.1 Gene:CG5984 / 43281 FlyBaseID:FBgn0039500 Length:271 Species:Drosophila melanogaster


Alignment Length:195 Identity:44/195 - (22%)
Similarity:56/195 - (28%) Gaps:71/195 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  8599 SRSSLSASTPDSLSDNEGSHGGPSGRY--TPRKVTYTS-----------TRTGLT-----PGGS- 8644
            |.:|..:|:...|..|....||..|||  ||....|.|           |..|..     |.|: 
  Fly    16 SSASACSSSGSGLEGNSPEEGGIFGRYQRTPDADAYPSESPRVYVAPELTDAGKVQLLHFPSGAV 80

  Fly  8645 -----------RAGSK---------PNSRPLS--RQGSKPPSRHGSTLSLDSTDDHTPSRIPQRK 8687
                       |.|.|         |:.:|:.  ||....|.|......||              
  Fly    81 RVNSPLGFIIKRNGVKGNFEVRVEGPSGQPIQPVRQQQLDPERFQIDCQLD-------------- 131

  Fly  8688 PSTGSTASGTTPRPARLSVTTTTTPGSRL------NGTSTITRKTASGSASPAPTSNGGMSRSSS 8746
                   :|.......:...:.|.|.|..      ..|.:|..|.||.|   .|.|:...||..|
  Fly   132 -------AGAGLYKVHIKCNSVTLPRSPFIIVAIAGATESIDGKPASSS---VPISDSDASRVQS 186

  Fly  8747  8746
              Fly   187  186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shotNP_725339.1 SAC6 204..>420 CDD:227401
CH 223..327 CDD:306753
SPEC 471..689 CDD:238103
SPEC 690..866 CDD:238103
SH3 885..922 CDD:327375
SPEC 1047..1250 CDD:238103
SPEC 1153..1390 CDD:238103
PLEC <1498..1526 CDD:197605
Plectin 1949..1981 CDD:307019
DNA_pol3_delta2 <2711..3178 CDD:331068
DUF4775 3026..3357 CDD:330579
SMC_N <4904..5566 CDD:330553
SPEC 5304..5513 CDD:238103
SPEC <5658..5787 CDD:321951
SPEC 5793..6007 CDD:238103
SPEC 6011..6220 CDD:238103
SPEC 6118..6330 CDD:238103
PRK09039 <6279..6441 CDD:332967
SPEC 6443..6660 CDD:238103
SPEC 6663..6878 CDD:238103
SPEC 6880..7087 CDD:238103
SPEC 6986..7196 CDD:238103
SPEC 7196..7417 CDD:238103
SPEC 7314..7526 CDD:238103
SPEC 7528..7747 CDD:238103
SPEC 7749..7968 CDD:238103
SPEC 7973..8181 CDD:238103
EF-hand_7 8373..8437 CDD:316058
GAS2 8450..8522 CDD:128539
Herpes_ICP4_C 8550..>8795 CDD:332854 44/195 (23%)
CG5984NP_651548.1 Filamin 65..154 CDD:279024 19/109 (17%)
Filamin 179..266 CDD:279024 3/8 (38%)
IG_FLMN 181..271 CDD:214720 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.