DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13344 and rnf25

DIOPT Version :9

Sequence 1:NP_001027416.2 Gene:CG13344 / 36541 FlyBaseID:FBgn0033884 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_002940633.2 Gene:rnf25 / 496760 XenbaseID:XB-GENE-994718 Length:377 Species:Xenopus tropicalis


Alignment Length:351 Identity:111/351 - (31%)
Similarity:171/351 - (48%) Gaps:55/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DALQDEVESLEAILMDDVCIKRTPSGEVEQIETTVLPLTGEEEEQQYVCVTLQVHPTPGYPEESP 66
            ::||.|::.||:|..|::.|.|   ||...:..|:.|.||.:||.|||.:||::...|.||.|.|
 Frog    10 ESLQQELQVLESIYPDELQICR---GERVVLSITLHPATGHDEETQYVRITLELSLPPKYPAEVP 71

  Fly    67 TFKLLRPRGLDDARLEAIRSACNAKIKESIGFPVVFDLIEVVREHLSGSNLPSGQCVVCLYGFAD 131
            ...:..||||.|.::.:|.|:..:..::.:|.|::::|||..:|.|:.||:|.|.||:|||.|.:
 Frog    72 EISVKNPRGLCDDQINSIVSSLRSVAEQGVGCPILYELIEKGKEMLTDSNIPRGHCVICLYNFQE 136

  Fly   132 GDEFTRTECFHYLHSYCLARHLNALRRNYQEEFDKLPAWLQKTADPFQALCPVCREHIGDETDSL 196
            ||..|:|.|||:.|||||.|:     ..:..|        ||..:....|||||||.:..:...|
 Frog   137 GDSLTKTPCFHHFHSYCLGRY-----AQHSTE--------QKQMEELSVLCPVCREDVTCDIIKL 188

  Fly   197 KCAMPP--SELLNAPEFKVTEELRQMQQRMSELYLQQKSRGAIIDVNAEGSA-VISIETEEDIRR 258
            :.|.||  .|.:..|:....|:    |:.:.::|..|.::|.|||:.||.:. .|||:...    
 Frog   189 QAAPPPLHPEEIYTPDCITLEK----QKELHQIYQAQLAKGGIIDIEAERNRFFISIQEPP---- 245

  Fly   259 RRRREEAEAAKKLEGPSKEEVIKPTTSSTFAPVVQETHRIMPEPTNNNY-----HHNR------- 311
                           |..:.|::|......:| ..|.....|.|..:..     |..|       
 Frog   246 ---------------PQFDAVLEPQPDEVQSP-QPELEPPPPPPVESKLPCSRGHPGRQRPGYRS 294

  Fly   312 RHYRGGRRHHHHHQHGHHHRAERERG 337
            :|||.....|:.:.|.||.|..:..|
 Frog   295 QHYRPVHTDHNANSHLHHGRGRKFHG 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13344NP_001027416.2 RWD 7..115 CDD:214735 39/107 (36%)
zf-RING_2 120..186 CDD:290367 27/65 (42%)
rnf25XP_002940633.2 RWD 12..117 CDD:399058 40/107 (37%)
RING-H2_RNF25 126..179 CDD:319384 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9033
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4014
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D294594at33208
OrthoFinder 1 1.000 - - FOG0006434
OrthoInspector 1 1.000 - - oto104630
Panther 1 1.100 - - LDO PTHR13198
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.