DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and UBA3

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_003959.3 Gene:UBA3 / 9039 HGNCID:12470 Length:463 Species:Homo sapiens


Alignment Length:431 Identity:277/431 - (64%)
Similarity:344/431 - (79%) Gaps:6/431 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RFNGLRNILEREGPFCKDGFAASSENLEFLQTKCQVLIIGAGGLGCELLKDLALMGFGNLHVIDM 80
            |:|.::..|||.|||....|..|:|:|:||...|:||:||||||||||||:|||.||..:|||||
Human    37 RWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDM 101

  Fly    81 DTIELSNLNRQFLFRRTDIGASKAECAARFINARVPTCRVTPHFKKIQDFDESFYQQFHLVVCGL 145
            |||::||||||||||..|||..|||.||.|:|.|||.|.|.|||.|||||:::||:|||::||||
Human   102 DTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGL 166

  Fly   146 DSIVARRWINGMLLSMLRYEEDGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPP 210
            |||:|||||||||:|:|.| |||.:|.|||||:||||||||||||||||||.||||||||:|:||
Human   167 DSIIARRWINGMLISLLNY-EDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPP 230

  Fly   211 QVNYPLCTIANTPRLPEHCIEYVKIIQWEKQNPF--GVPLDGDDPQHIGWIYERALERSNEFNIT 273
            |||:|:||||:.|||||||||||:::||.|:.||  |||||||||:||.||::::|||::::||.
Human   231 QVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIR 295

  Fly   274 GVTYRLVQGVVKHIIPAVASTNAAIAAACALEVFKLATSCYDSMANYLNFNDLDGIYTYTYEAEK 338
            ||||||.|||||.||||||||||.|||.||.||||:|||.|..:.|||.|||:||:||||:|||:
Human   296 GVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAER 360

  Fly   339 SENCLACSNTPQPLPIEDPNTTTLEDVIKLLCDSPRFQLKSPALTTVMKDGKRRTLYMSGVKSIE 403
            .|||.|||..||  .|:...:..|::|:..|.:|...|:||||:|..: :||.||||:..|.|||
Human   361 KENCPACSQLPQ--NIQFSPSAKLQEVLDYLTNSASLQMKSPAITATL-EGKNRTLYLQSVTSIE 422

  Fly   404 EATRKNLTQSLGELGLHDGQQLTVTDATSPSAMTLQLKYQS 444
            |.||.||:::|.||||.|||:|.|.|.|:|..:..:|.:.|
Human   423 ERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 129/171 (75%)
Uba3_RUB 50..346 CDD:238765 217/297 (73%)
E2_bind 357..442 CDD:285976 39/84 (46%)
UBA3NP_003959.3 Interaction with UBE2M N-terminus 53..70 6/16 (38%)
Uba3_RUB 71..368 CDD:238765 217/297 (73%)
Interaction with UBE2M N-terminus 157..161 2/3 (67%)
Interaction with UBE2M N-terminus 192..217 22/24 (92%)
Interaction with NEDD8 227..229 1/1 (100%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 242..248 4/5 (80%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 292..295 1/2 (50%)
Interaction with UBE2M N-terminus 331..338 4/6 (67%)
Interaction with NEDD8 352..357 4/4 (100%)
Interaction with UBE2M core domain 368..463 43/97 (44%)
E2_bind 376..461 CDD:400951 39/85 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159764
Domainoid 1 1.000 468 1.000 Domainoid score I460
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2951
Inparanoid 1 1.050 573 1.000 Inparanoid score I1046
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54659
OrthoDB 1 1.010 - - D256073at33208
OrthoFinder 1 1.000 - - FOG0005107
OrthoInspector 1 1.000 - - oto91829
orthoMCL 1 0.900 - - OOG6_101845
Panther 1 1.100 - - LDO PTHR10953
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1578
SonicParanoid 1 1.000 - - X3628
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.