DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and AOS1

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_015506.1 Gene:AOS1 / 856310 SGDID:S000006384 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:33/95 - (34%)
Similarity:50/95 - (52%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINAR 114
            :||:|..|.:|.|:.|.:.|.|.|:|.::|...:...:|..||.....|:|..|.:.....|...
Yeast    35 KVLLINLGAIGSEITKSIVLSGIGHLTILDGHMVTEEDLGSQFFIGSEDVGQWKIDATKERIQDL 99

  Fly   115 VPTCRVTPHFKK--IQDFDESFYQQFHLVV 142
            .|  |:..:|.|  :|:.||.|:|||.|||
Yeast   100 NP--RIELNFDKQDLQEKDEEFFQQFDLVV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 33/95 (35%)
Uba3_RUB 50..346 CDD:238765 33/95 (35%)
E2_bind 357..442 CDD:285976
AOS1NP_015506.1 Aos1_SUMO 13..345 CDD:238769 33/95 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.