DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and UBA1

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_016885266.1 Gene:UBA1 / 7317 HGNCID:12469 Length:1109 Species:Homo sapiens


Alignment Length:260 Identity:83/260 - (31%)
Similarity:129/260 - (49%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEREGPFCKDG-FAASSENLEFLQTKCQVLIIGAGGLGCELLKDLALMGF-----GNLHVIDMDT 82
            |:|:..:  || .|....:|:....|.:..::|||.:||||||:.|::|.     |.:.|.||||
Human   496 LQRQNRY--DGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEIIVTDMDT 558

  Fly    83 IELSNLNRQFLFRRTDIGASKAECAARFINARVPTCRVTPHFKKI-----QDFDESFYQQFHLVV 142
            ||.||||||||||..|:...|::.||..:....|..|||.|..::     :.:|:.|:|....|.
Human   559 IEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIYDDDFFQNLDGVA 623

  Fly   143 CGLDSIVARRWINGMLLSMLRYEEDGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDL 207
            ..||::.||.:::...:...:             |:::.||.|.|||.:|::|..|.....:.| 
Human   624 NALDNVDARMYMDRRCVYYRK-------------PLLESGTLGTKGNVQVVIPFLTESYSSSQD- 674

  Fly   208 FPPQVNYPLCTIANTPRLPEHCIEYVKIIQW---EKQNPFGVPLDG-----DDPQHIGWIYERAL 264
             ||:.:.|:||:.|.|...||      .:||   |.:..|..|.:.     .||:.:    ||.|
Human   675 -PPEKSIPICTLKNFPNAIEH------TLQWARDEFEGLFKQPAENVNQYLTDPKFV----ERTL 728

  Fly   265  264
            Human   729  728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 63/181 (35%)
Uba3_RUB 50..346 CDD:238765 76/233 (33%)
E2_bind 357..442 CDD:285976
UBA1XP_016885266.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.