DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Uba5

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_079968.2 Gene:Uba5 / 66663 MGIID:1913913 Length:403 Species:Mus musculus


Alignment Length:420 Identity:82/420 - (19%)
Similarity:145/420 - (34%) Gaps:121/420 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFI---- 111
            |.|:|.||:|....:.|...|.|.|.:.|.|.:||:|:||.| |:....|.||...|...:    
Mouse    74 VAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLF-FQPYQAGLSKVHAAEHTLRNIN 137

  Fly   112 --------NARVPTCRVTPHF-KKIQDFDESFYQQFHLVVCGLDSIVARRWINGMLLSM-LRYEE 166
                    |..:.|.....|| .:|.:......|...||:..:|:..||..||.....: ..:.|
Mouse   138 PDVLFEVHNYNITTVEHFEHFMNRISNGGLEEGQPVDLVLSCVDNFEARMAINTACNELGQTWME 202

  Fly   167 DGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEHCIE 231
            .|..:.:            ..|:.::::||.:||..|.    ||.|      :|:.         
Mouse   203 SGVSENA------------VSGHIQLMIPGESACFACA----PPLV------VASN--------- 236

  Fly   232 YVKIIQWEKQNPFGVPLDGDDPQHIGWIYERALERSNEFNITGVTYRLVQGVVKHIIPAVASTNA 296
                                       |.|:.|:|              :||....:|   :|..
Mouse   237 ---------------------------IDEKTLKR--------------EGVCAASLP---TTMG 257

  Fly   297 AIAAACALEVFKLATSCYDSMANYLNFNDLDGIYTYTYEAEKSENCLACSNTPQPLPIEDPNTTT 361
            .:|......|.|.... :.:::.||.:|.:...:...:            ..|.| ..:|.|...
Mouse   258 VVAGILVQNVLKFLLK-FGTVSFYLGYNAMQDFFPTMF------------MKPNP-QCDDKNCR
K 308

  Fly   362 LEDVIKLLCDSPRFQLKSPALTTVMKDGKRRTLYMS-----GVKSIEEATRKNLTQSLGEL-GLH 420
            .::         .::.::.||.|...:.:.....:.     |::.:.|.:.:.|..|.|.: .|.
Mouse   309 QQE---------EYKKRAAALPTQEAEPQEEAEVVHEDNEWGIELVSEVSEEELKNSSGPVPTLP 364

  Fly   421 DGQQL--TVTDATSPSAMTLQLKYQSNEVE 448
            :|..:  ||...|..||..:.::.....:|
Mouse   365 EGITVAYTVPKKTEDSASEVTVEDSGESLE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 47/182 (26%)
Uba3_RUB 50..346 CDD:238765 62/308 (20%)
E2_bind 357..442 CDD:285976 16/92 (17%)
Uba5NP_079968.2 ThiF_MoeB_HesA_family 50..293 CDD:238386 62/295 (21%)
ThiF 51..307 CDD:279270 66/322 (20%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 333..345 1/11 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.