DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Sae1

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001272820.1 Gene:Sae1 / 56459 MGIID:1929264 Length:350 Species:Mus musculus


Alignment Length:103 Identity:30/103 - (29%)
Similarity:50/103 - (48%) Gaps:3/103 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINAR 114
            :|||:|..|||.|:.|:|.|.|...|.::|.:.:...:...|||.:...:|.::||.:.......
Mouse    42 RVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDPGAQFLIQTGSVGRNRAEASLERAQNL 106

  Fly   115 VPTCRVTPHFKKIQDFDESFYQQFH---LVVCGLDSIV 149
            .|...|....:.::...|||:.:|.   |..|..|.|:
Mouse   107 NPMVDVKVDTEDVEKKPESFFTKFDAVCLTCCSRDVII 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 30/103 (29%)
Uba3_RUB 50..346 CDD:238765 30/103 (29%)
E2_bind 357..442 CDD:285976
Sae1NP_001272820.1 Aos1_SUMO 20..345 CDD:238769 30/103 (29%)
ThiF 23..338 CDD:279270 30/103 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.